PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g15540
Common NameGSCOC_T00033738001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 269aa    MW: 29209.2 Da    PI: 8.0273
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g15540genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.75.1e-3263118359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++r++eClkNhA+++GghavDGCgEfm++ geegt ++lkCaAC+CHRnFHR+e+e 
  Cc10_g15540  63 SYRFRECLKNHAVAIGGHAVDGCGEFMAA-GEEGTLESLKCAACNCHRNFHRKETEG 118
                  689*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.2E-2964116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2265117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-2965115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.15566115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.99E-21191266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-32194267IPR009057Homeodomain-like
TIGRFAMsTIGR015654.9E-25205261IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MEFDEHEEQE EEIGMHQMQA GNYQTLGNSA GRGGGGEGVS AATTARKNGG GGGSMATTST  60
TTSYRFRECL KNHAVAIGGH AVDGCGEFMA AGEEGTLESL KCAACNCHRN FHRKETEGEG  120
FHQPHPTPHH PHHHHPHHAH HQFSPAYPFR SPHPSGYLHV TPPSHHHHQR PLPLPSTSRE  180
DEDVSNPSSS GGGGGGGSGG AGGSKKRFRT KFTPDQKEKM LAFAERLGWR IQKQDEALVQ  240
QFCAETNVKR HVLKVWMHNN KHSLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-282042631675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602563.11e-95PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH53e-76ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A068USE60.0A0A068USE6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000336249e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-67homeobox protein 22